General Information

  • ID:  hor004652
  • Uniprot ID:  Q8S8N1
  • Protein name:  CLAVATA3/ESR (CLE)-related protein 7
  • Gene name:  CLE7
  • Organism:  Arabidopsis thaliana (Mouse-ear cress)
  • Family:  CLV3/ESR signal peptide family
  • Source:  Plant
  • Expression:  [CLE7p]: Expressed in roots and seedlings.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Arabidopsis (genus), Camelineae (tribe), Brassicaceae (family), Brassicales (order), malvids, rosids, Pentapetalae, Gunneridae, eudicotyledons, Mesangiospermae, Magnoliopsida (class), Spermatophyta, Euphyllophyta, Tracheophyta, Embryophyta, Streptophytina (subphylum), Streptophyta (phylum), Viridiplantae (kingdom), Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0030154 cell differentiation; GO:0045168 cell-cell signaling involved in cell fate commitment
  • GO CC:  GO:0005576 extracellular region; GO:0048046 apoplast

Sequence Information

  • Sequence:  RILRVNSKTKDGESNDLLKRLGYNVSELKRIGRELSVQNEVDRFSPGGPDPQHHSYPLSSKPRI
  • Length:  64
  • Propeptide:  MASKALLLFVMLTFLLVIEMEGRILRVNSKTKDGESNDLLKRLGYNVSELKRIGRELSVQNEVDRFSPGGPDPQHHSYPLSSKPRI
  • Signal peptide:  MASKALLLFVMLTFLLVIEMEG
  • Modification:  T46 Hydroxyproline;T49 Hydroxyproline
  • Glycosylation:  T24 N-linked (GlcNAc...) asparagine;T49 O-linked (Ara...) hydroxyproline
  • Mutagenesis:  NA

Activity

  • Function:  Extracellular signal peptide that regulates cell fate.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q8S8N1-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004652_AF2.pdbhor004652_ESM.pdb

Physical Information

Mass: 841006 Formula: C316H518N100O98
Absent amino acids: ACMW Common amino acids: SLR
pI: 10.46 Basic residues: 14
Polar residues: 20 Hydrophobic residues: 15
Hydrophobicity: -103.75 Boman Index: -19828
Half-Life: 1 hour Half-Life Yeast: 2 min
Half-Life E.Coli: 2 min Aliphatic Index 79.06
Instability Index: 3645 Extinction Coefficient cystines: 2980
Absorbance 280nm: 47.3

Literature

  • PubMed ID:  NA
  • Title:  NA